Big dynorphin is an endogenous opioid peptide of the dynorphin family that is composed of both dynorphin A and dynorphin B.[1][2] Big dynorphin has the amino acid sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr.[2] It has nociceptive and anxiolytic-like properties, as well as effects on memory in mice.[3][4]

Big dynorphin is a principal endogenous, agonist at the human kappa-opioid receptor.[1][5]

References

  1. 1 2 "Big dynorphin: Biological activity". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Principal endogenous agonists at κ receptor
  2. 1 2 "Big dynorphin: Structure – Peptide Sequence". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Peptide sequence
    YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
    Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr
  3. Kuzmin, Alexander; Madjid, Nather; Terenius, Lars; Ogren, Sven Ove; Bakalkin, Georgy (2005). "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology. 31 (9): 1928–1937. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
  4. Tan-No K, Esashi A, Nakagawasai O, et al. (2002). "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. doi:10.1016/S0006-8993(02)03180-3. PMID 12363399. S2CID 1734522.
  5. Merg F, Filliol D, Usynin I, et al. (2006). "Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor". J. Neurochem. 97 (1): 292–301. doi:10.1111/j.1471-4159.2006.03732.x. PMID 16515546.


This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.